SCOPe 2.01: Domain d2dp9a_: 2dp9 A:

Lineage for d2dp9a_ (2dp9 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (2 proteins)
   Pfam PF04266; DUF437

6. Protein automated matches [190268] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187058] (1 PDB entry)

8. Domain d2dp9a_: 2dp9 A: [131609]
   automated match to d1wk2a_

Details for d2dp9a_

PDB Entry: 2dp9, 1.9 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8

PDB Compounds: (A:) Hypothetical protein TTHA0113

SCOPe Domain Sequences for d2dp9a_:

Sequence; same for both SEQRES and ATOM records:

>d2dp9a_ b.122.1.5 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mdymerpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgveg
pfsveellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdls
evrw

Timeline for d2dp9a_:

• d2dp9a_ first appeared in SCOP 1.73, called d2dp9a1
  
• d2dp9a_ was called d2dp9a1 in SCOP 1.75
  
• d2dp9a_ appears in SCOPe 2.02
  
• d2dp9a_ appears in the current release, SCOPe 2.08, called d2dp9a2