SCOP 1.75: Domain d2dp9a1: 2dp9 A:1-120

Lineage for d2dp9a1 (2dp9 A:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (1 protein)
   Pfam PF04266; DUF437

6. Protein Hypothetical protein TTHA0113 [117349] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117350] (2 PDB entries)
   Uniprot Q5SM30

8. Domain d2dp9a1: 2dp9 A:1-120 [131609]
   automatically matched to d1wk2a_

Details for d2dp9a1

PDB Entry: 2dp9, 1.9 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8

PDB Compounds: (A:) Hypothetical protein TTHA0113

SCOP Domain Sequences for d2dp9a1:

Sequence; same for both SEQRES and ATOM records:

>d2dp9a1 b.122.1.5 (A:1-120) Hypothetical protein TTHA0113 {Thermus thermophilus [TaxId: 274]}
merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs
veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr

Timeline for d2dp9a1:

• d2dp9a1 first appeared in SCOP 1.73
  
• d2dp9a1 is called d2dp9a_ in SCOPe 2.01
  
• d2dp9a1 appears in the current release, SCOPe 2.08, called d2dp9a2