SCOPe 2.08: Domain d2dp9a2: 2dp9 A:1-121

Lineage for d2dp9a2 (2dp9 A:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (1 protein)
   Pfam PF04266; DUF437

6. Protein Hypothetical protein TTHA0113 [117349] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [187058] (1 PDB entry)

8. Domain d2dp9a2: 2dp9 A:1-121 [131609]
   Other proteins in same PDB: d2dp9a3
   automated match to d1wk2a_

Details for d2dp9a2

PDB Entry: 2dp9, 1.9 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8

PDB Compounds: (A:) Hypothetical protein TTHA0113

SCOPe Domain Sequences for d2dp9a2:

Sequence; same for both SEQRES and ATOM records:

>d2dp9a2 b.122.1.5 (A:1-121) Hypothetical protein TTHA0113 {Thermus thermophilus HB8 [TaxId: 300852]}
merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs
veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr
w

Timeline for d2dp9a2:

• d2dp9a2 first appeared in SCOP 1.73, called d2dp9a1
  
• d2dp9a2 appears in SCOPe 2.07