![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (1 protein) Pfam PF04266; DUF437 |
![]() | Protein Hypothetical protein TTHA0113 [117349] (2 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187058] (1 PDB entry) |
![]() | Domain d2dp9a2: 2dp9 A:1-121 [131609] Other proteins in same PDB: d2dp9a3 automated match to d1wk2a_ |
PDB Entry: 2dp9 (more details), 1.9 Å
SCOPe Domain Sequences for d2dp9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dp9a2 b.122.1.5 (A:1-121) Hypothetical protein TTHA0113 {Thermus thermophilus HB8 [TaxId: 300852]} merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr w
Timeline for d2dp9a2: