Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (12 species) |
Species Serratia marcescens [TaxId:615] [190018] (5 PDB entries) |
Domain d2doob_: 2doo B: [131606] automated match to d1jjeb_ complexed with c4h, zn |
PDB Entry: 2doo (more details), 2.43 Å
SCOPe Domain Sequences for d2doob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doob_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]} lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll kskygkaklvvpshsevgdasllkltleqavkglne
Timeline for d2doob_: