Lineage for d2doob1 (2doo B:4-219)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736618Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 736619Protein Zn metallo-beta-lactamase [56283] (8 species)
  7. 736665Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (6 PDB entries)
  8. 736673Domain d2doob1: 2doo B:4-219 [131606]
    automatically matched to d1jjeb_
    complexed with c4h, zn

Details for d2doob1

PDB Entry: 2doo (more details), 2.43 Å

PDB Description: The structure of IMP-1 complexed with the detecting reagent (DansylC4SH) by a fluorescent probe
PDB Compounds: (B:) beta-lactamase imp-1

SCOP Domain Sequences for d2doob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doob1 d.157.1.1 (B:4-219) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

SCOP Domain Coordinates for d2doob1:

Click to download the PDB-style file with coordinates for d2doob1.
(The format of our PDB-style files is described here.)

Timeline for d2doob1: