Lineage for d2doob_ (2doo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996787Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)
  8. 2996794Domain d2doob_: 2doo B: [131606]
    automated match to d1jjeb_
    complexed with c4h, zn

Details for d2doob_

PDB Entry: 2doo (more details), 2.43 Å

PDB Description: The structure of IMP-1 complexed with the detecting reagent (DansylC4SH) by a fluorescent probe
PDB Compounds: (B:) beta-lactamase imp-1

SCOPe Domain Sequences for d2doob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doob_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

SCOPe Domain Coordinates for d2doob_:

Click to download the PDB-style file with coordinates for d2doob_.
(The format of our PDB-style files is described here.)

Timeline for d2doob_: