SCOPe 2.07: Domain d2dooa_: 2doo A:

Lineage for d2dooa_ (2doo A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)

8. Domain d2dooa_: 2doo A: [131605]
   automated match to d1jjeb_
   complexed with c4h, zn

Details for d2dooa_

PDB Entry: 2doo, 2.43 Å

PDB Description: The structure of IMP-1 complexed with the detecting reagent (DansylC4SH) by a fluorescent probe

PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d2dooa_:

Sequence; same for both SEQRES and ATOM records:

>d2dooa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

Timeline for d2dooa_:

• d2dooa_ first appeared in SCOP 1.73, called d2dooa1
  
• d2dooa_ appears in SCOPe 2.06
  
• d2dooa_ appears in the current release, SCOPe 2.08