Lineage for d2dooa_ (2doo A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231326Species Serratia marcescens [TaxId:615] [190018] (5 PDB entries)
  8. 2231329Domain d2dooa_: 2doo A: [131605]
    automated match to d1jjeb_
    complexed with c4h, zn

Details for d2dooa_

PDB Entry: 2doo (more details), 2.43 Å

PDB Description: The structure of IMP-1 complexed with the detecting reagent (DansylC4SH) by a fluorescent probe
PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d2dooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dooa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

SCOPe Domain Coordinates for d2dooa_:

Click to download the PDB-style file with coordinates for d2dooa_.
(The format of our PDB-style files is described here.)

Timeline for d2dooa_: