SCOP 1.73: Domain d2dooa1: 2doo A:4-219

Lineage for d2dooa1 (2doo A:4-219)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (8 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (6 PDB entries)

8. Domain d2dooa1: 2doo A:4-219 [131605]
   automatically matched to d1jjeb_
   complexed with c4h, zn

Details for d2dooa1

PDB Entry: 2doo, 2.43 Å

PDB Description: The structure of IMP-1 complexed with the detecting reagent (DansylC4SH) by a fluorescent probe

PDB Compounds: (A:) beta-lactamase imp-1

SCOP Domain Sequences for d2dooa1:

Sequence; same for both SEQRES and ATOM records:

>d2dooa1 d.157.1.1 (A:4-219) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

Timeline for d2dooa1:

• d2dooa1 is new in SCOP 1.73
  
• d2dooa1 appears in SCOP 1.75
  
• d2dooa1 appears in the current release, SCOPe 2.08, called d2dooa_