![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) |
![]() | Protein Zn metallo-beta-lactamase [56283] (8 species) |
![]() | Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (6 PDB entries) |
![]() | Domain d2dooa1: 2doo A:4-219 [131605] automatically matched to d1jjeb_ complexed with c4h, zn |
PDB Entry: 2doo (more details), 2.43 Å
SCOP Domain Sequences for d2dooa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dooa1 d.157.1.1 (A:4-219) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll kskygkaklvvpshsevgdasllkltleqavkglne
Timeline for d2dooa1: