Lineage for d2doix2 (2doi X:164-245)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033370Domain d2doix2: 2doi X:164-245 [131603]
    automatically matched to d1ki0a2

Details for d2doix2

PDB Entry: 2doi (more details), 3.1 Å

PDB Description: the x-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound to a peptide from the group a streptococcus protein pam
PDB Compounds: (X:) angiostatin

SCOPe Domain Sequences for d2doix2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doix2 g.14.1.1 (X:164-245) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
eecmhcsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrelr
pwcfttdpnkrwelcdiprctt

SCOPe Domain Coordinates for d2doix2:

Click to download the PDB-style file with coordinates for d2doix2.
(The format of our PDB-style files is described here.)

Timeline for d2doix2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2doix1