Lineage for d2doix1 (2doi X:81-163)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638080Protein Plasminogen [63400] (1 species)
  7. 2638081Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 2638109Domain d2doix1: 2doi X:81-163 [131602]
    automatically matched to d1ki0a1

Details for d2doix1

PDB Entry: 2doi (more details), 3.1 Å

PDB Description: the x-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound to a peptide from the group a streptococcus protein pam
PDB Compounds: (X:) angiostatin

SCOPe Domain Sequences for d2doix1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doix1 g.14.1.1 (X:81-163) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
qgpwcyttdpekrydycdilece

SCOPe Domain Coordinates for d2doix1:

Click to download the PDB-style file with coordinates for d2doix1.
(The format of our PDB-style files is described here.)

Timeline for d2doix1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2doix2