![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Plasminogen [63400] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries) |
![]() | Domain d2doix1: 2doi X:81-163 [131602] automatically matched to d1ki0a1 |
PDB Entry: 2doi (more details), 3.1 Å
SCOPe Domain Sequences for d2doix1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doix1 g.14.1.1 (X:81-163) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp qgpwcyttdpekrydycdilece
Timeline for d2doix1: