SCOPe 2.08: Domain d2doia1: 2doi A:81-163

Lineage for d2doia1 (2doi A:81-163)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)

8. Domain d2doia1: 2doi A:81-163 [131600]
   automatically matched to d1ki0a1

Details for d2doia1

PDB Entry: 2doi, 3.1 Å

PDB Description: the x-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound to a peptide from the group a streptococcus protein pam

PDB Compounds: (A:) angiostatin

SCOPe Domain Sequences for d2doia1:

Sequence; same for both SEQRES and ATOM records:

>d2doia1 g.14.1.1 (A:81-163) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
qgpwcyttdpekrydycdilece

Timeline for d2doia1:

• d2doia1 first appeared in SCOP 1.73
  
• d2doia1 appears in SCOPe 2.07