SCOP 1.73: Domain d2dohx2: 2doh X:164-245

Lineage for d2dohx2 (2doh X:164-245)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (18 PDB entries)

8. Domain d2dohx2: 2doh X:164-245 [131599]
   automatically matched to d1ki0a2
   complexed with dio; mutant

Details for d2dohx2

PDB Entry: 2doh, 2.3 Å

PDB Description: the x-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound a to a peptide from the group a streptococcal surface protein pam

PDB Compounds: (X:) angiostatin

SCOP Domain Sequences for d2dohx2:

Sequence; same for both SEQRES and ATOM records:

>d2dohx2 g.14.1.1 (X:164-245) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
eecmhcsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrelr
pwcfttdpnkrwelcdiprctt

Timeline for d2dohx2:

• d2dohx2 is new in SCOP 1.73
  
• d2dohx2 appears in SCOP 1.75
  
• d2dohx2 appears in the current release, SCOPe 2.08