SCOPe 2.08: Domain d2do8a1: 2do8 A:1-186

Lineage for d2do8a1 (2do8 A:1-186)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.310: VC0467-like [143455] (1 superfamily)
   complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel

4. Superfamily d.310.1: VC0467-like [143456] (2 families)
   automatically mapped to Pfam PF02622

5. Family d.310.1.1: VC0467-like [143457] (5 proteins)
   Pfam PF02622; DUF179

6. Protein Hypothetical protein HD1794 [143460] (1 species)

7. Species Haemophilus ducreyi [TaxId:730] [143461] (1 PDB entry)
   Uniprot Q7VKS7 1-186

8. Domain d2do8a1: 2do8 A:1-186 [131597]
   Other proteins in same PDB: d2do8a2

Details for d2do8a1

PDB Entry: 2do8

PDB Description: solution structure of upf0301 protein hd_1794

PDB Compounds: (A:) UPF0301 protein HD_1794

SCOPe Domain Sequences for d2do8a1:

Sequence; same for both SEQRES and ATOM records:

>d2do8a1 d.310.1.1 (A:1-186) Hypothetical protein HD1794 {Haemophilus ducreyi [TaxId: 730]}
mfgnlqgkfiiatpemddeyfdrtviyicehndngtigviintptdlsvlelltrmdfqm
akpriytqdqmvlnggpvnqdrgfivhsktdhefthsykvtdditlttsgdvldsfgtqt
apekfivclgcstwkphqleqeiaqnywllseannqtlfetsyldrwveanemlgisgil
apagra

Timeline for d2do8a1:

• d2do8a1 first appeared in SCOP 1.73
  
• d2do8a1 appears in SCOPe 2.07