SCOPe 2.08: Domain d2do3a1: 2do3 A:462-523

Lineage for d2do3a1 (2do3 A:462-523)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.5: SPT5 KOW domain-like [141242] (1 protein)
   part of Pfam PF00467

6. Protein Transcription elongation factor SPT5 [141243] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141244] (1 PDB entry)
   Uniprot O00267 462-523

8. Domain d2do3a1: 2do3 A:462-523 [131596]
   Other proteins in same PDB: d2do3a2

Details for d2do3a1

PDB Entry: 2do3

PDB Description: solution structure of the third kow motif of transcription elongation factor spt5

PDB Compounds: (A:) Transcription elongation factor SPT5

SCOPe Domain Sequences for d2do3a1:

Sequence; same for both SEQRES and ATOM records:

>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]}
efpaqelrkyfkmgdhvkviagrfegdtglivrveenfvilfsdltmhelkvlprdlqlc
se

Timeline for d2do3a1:

• d2do3a1 first appeared in SCOP 1.73
  
• d2do3a1 appears in SCOPe 2.07