Lineage for d2do3a1 (2do3 A:462-523)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377951Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2378220Family b.34.5.5: SPT5 KOW domain-like [141242] (1 protein)
    part of Pfam PF00467
  6. 2378221Protein Transcription elongation factor SPT5 [141243] (1 species)
  7. 2378222Species Human (Homo sapiens) [TaxId:9606] [141244] (1 PDB entry)
    Uniprot O00267 462-523
  8. 2378223Domain d2do3a1: 2do3 A:462-523 [131596]
    Other proteins in same PDB: d2do3a2

Details for d2do3a1

PDB Entry: 2do3 (more details)

PDB Description: Solution structure of the third KOW motif of transcription elongation factor SPT5
PDB Compounds: (A:) Transcription elongation factor SPT5

SCOPe Domain Sequences for d2do3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]}
efpaqelrkyfkmgdhvkviagrfegdtglivrveenfvilfsdltmhelkvlprdlqlc
se

SCOPe Domain Coordinates for d2do3a1:

Click to download the PDB-style file with coordinates for d2do3a1.
(The format of our PDB-style files is described here.)

Timeline for d2do3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2do3a2