![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein Chromobox protein homolog 8 [141214] (1 species) Polycomb 3 homolog, Pc3 |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141215] (1 PDB entry) Uniprot Q9QXV1 7-58 |
![]() | Domain d2dnva1: 2dnv A:8-58 [131594] |
PDB Entry: 2dnv (more details)
SCOPe Domain Sequences for d2dnva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dnva1 b.34.13.2 (A:8-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} ervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafe
Timeline for d2dnva1: