Lineage for d2dnsb_ (2dns B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013424Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 3013425Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 3013457Domain d2dnsb_: 2dns B: [131588]
    automated match to d2dnsa1
    complexed with ba, dpn

Details for d2dnsb_

PDB Entry: 2dns (more details), 2.4 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with D-Phenylalanine
PDB Compounds: (B:) D-amino acid amidase

SCOPe Domain Sequences for d2dnsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnsb_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOPe Domain Coordinates for d2dnsb_:

Click to download the PDB-style file with coordinates for d2dnsb_.
(The format of our PDB-style files is described here.)

Timeline for d2dnsb_: