Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein D-Amino acid amidase DaaA [144038] (1 species) |
Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries) Uniprot Q9LCC8 2-363 |
Domain d2dnsb_: 2dns B: [131588] automated match to d2dnsa1 complexed with ba, dpn |
PDB Entry: 2dns (more details), 2.4 Å
SCOPe Domain Sequences for d2dnsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dnsb_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns rs
Timeline for d2dnsb_: