Lineage for d2dnsa_ (2dns A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619053Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 2619054Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 2619085Domain d2dnsa_: 2dns A: [131587]
    automated match to d2dnsa1
    complexed with ba, dpn

Details for d2dnsa_

PDB Entry: 2dns (more details), 2.4 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with D-Phenylalanine
PDB Compounds: (A:) D-amino acid amidase

SCOPe Domain Sequences for d2dnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnsa_ e.3.1.1 (A:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOPe Domain Coordinates for d2dnsa_:

Click to download the PDB-style file with coordinates for d2dnsa_.
(The format of our PDB-style files is described here.)

Timeline for d2dnsa_: