Lineage for d2dnaa1 (2dna A:12-61)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636439Protein Ubiquilin-like protein Ubqlnl [140339] (1 species)
  7. 636440Species Mouse (Mus musculus) [TaxId:10090] [140340] (1 PDB entry)
  8. 636441Domain d2dnaa1: 2dna A:12-61 [131586]

Details for d2dnaa1

PDB Entry: 2dna (more details)

PDB Description: Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
PDB Compounds: (A:) unnamed protein product

SCOP Domain Sequences for d2dnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]}
lqapevrfskemeclqamgfvnynanlqaliatdgdtnaaiyklkssqgf

SCOP Domain Coordinates for d2dnaa1:

Click to download the PDB-style file with coordinates for d2dnaa1.
(The format of our PDB-style files is described here.)

Timeline for d2dnaa1: