Lineage for d2dnaa1 (2dna A:8-61)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696104Protein Ubiquilin-like protein Ubqlnl [140339] (1 species)
  7. 2696105Species Mouse (Mus musculus) [TaxId:10090] [140340] (1 PDB entry)
    Uniprot Q14DL0 561-610
  8. 2696106Domain d2dnaa1: 2dna A:8-61 [131586]
    Other proteins in same PDB: d2dnaa2, d2dnaa3

Details for d2dnaa1

PDB Entry: 2dna (more details)

PDB Description: solution structure of rsgi ruh-056, a uba domain from mouse cdna
PDB Compounds: (A:) unnamed protein product

SCOPe Domain Sequences for d2dnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnaa1 a.5.2.1 (A:8-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]}
pshslqapevrfskemeclqamgfvnynanlqaliatdgdtnaaiyklkssqgf

SCOPe Domain Coordinates for d2dnaa1:

Click to download the PDB-style file with coordinates for d2dnaa1.
(The format of our PDB-style files is described here.)

Timeline for d2dnaa1: