Lineage for d2dmya1 (2dmy A:8-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946897Protein Spermatid perinuclear RNA-binding protein [143210] (1 species)
  7. 2946898Species Human (Homo sapiens) [TaxId:9606] [143211] (1 PDB entry)
    Uniprot Q96SI9 378-461
  8. 2946899Domain d2dmya1: 2dmy A:8-91 [131576]
    Other proteins in same PDB: d2dmya2, d2dmya3
    2nd dsRBD

Details for d2dmya1

PDB Entry: 2dmy (more details)

PDB Description: solution structure of dsrm domain in spermatid perinuclear rna-bind protein
PDB Compounds: (A:) Spermatid perinuclear RNA-binding protein

SCOPe Domain Sequences for d2dmya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}
rkildskaidlmnalmrlnqirpglqykllsqsgpvhapvftmsvdvdgttyeasgpskk
taklhvavkvlqamgyptgfdadi

SCOPe Domain Coordinates for d2dmya1:

Click to download the PDB-style file with coordinates for d2dmya1.
(The format of our PDB-style files is described here.)

Timeline for d2dmya1: