Lineage for d2dmba1 (2dmb A:8-118)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659093Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
    Pfam PF00630
  6. 659114Protein Filamin b [141025] (1 species)
  7. 659115Species Human (Homo sapiens) [TaxId:9606] [141026] (9 PDB entries)
  8. 659120Domain d2dmba1: 2dmb A:8-118 [131571]
    15th repeat

Details for d2dmba1

PDB Entry: 2dmb (more details)

PDB Description: solution structure of the 15th filamin domain from human filamin-b
PDB Compounds: (A:) Filamin-B

SCOP Domain Sequences for d2dmba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
tgdaskclatgpgiastvktgeevgfvvdaktagkgkvtctvltpdgteaeadvienedg
tydifytaakpgtyviyvrfggvdipnspftvmatdgevtaveeapvnacp

SCOP Domain Coordinates for d2dmba1:

Click to download the PDB-style file with coordinates for d2dmba1.
(The format of our PDB-style files is described here.)

Timeline for d2dmba1: