Lineage for d2dm6b2 (2dm6 B:113-294)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975120Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 975409Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110405] (1 species)
  7. 975410Species Guinea pig (Cavia porcellus) [TaxId:10141] [110406] (4 PDB entries)
    Uniprot Q9EQZ5
  8. 975412Domain d2dm6b2: 2dm6 B:113-294 [131570]
    Other proteins in same PDB: d2dm6a1, d2dm6b1
    automatically matched to d1v3ta2
    complexed with imn, nap, tam

Details for d2dm6b2

PDB Entry: 2dm6 (more details), 2 Å

PDB Description: crystal structure of anti-configuration of indomethacin and leukotriene b4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13- reductase complex
PDB Compounds: (B:) NADP-dependent leukotriene B4 12-hydroxydehydrogenase

SCOPe Domain Sequences for d2dm6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm6b2 c.2.1.1 (B:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
lplslalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvga
agsdekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkd
fgkiaicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvl
eg

SCOPe Domain Coordinates for d2dm6b2:

Click to download the PDB-style file with coordinates for d2dm6b2.
(The format of our PDB-style files is described here.)

Timeline for d2dm6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dm6b1