![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species) |
![]() | Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (4 PDB entries) Uniprot Q9EQZ5 |
![]() | Domain d2dm6b1: 2dm6 B:-4-112,B:295-329 [131569] Other proteins in same PDB: d2dm6a2, d2dm6b2 automated match to d1v3va1 complexed with imn, nap, tam |
PDB Entry: 2dm6 (more details), 2 Å
SCOPe Domain Sequences for d2dm6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dm6b1 b.35.1.2 (B:-4-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiq yhehvtkgfenmpaafiemlnganlgkavvta
Timeline for d2dm6b1: