SCOP 1.73: Domain d2dloa2: 2dlo A:43-75

Lineage for d2dloa2 (2dlo A:43-75)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Thyroid receptor interacting protein 6, TRIP6 [144177] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144178] (2 PDB entries)

8. Domain d2dloa2: 2dlo A:43-75 [131561]
   2nd LIM domain
   complexed with zn

Details for d2dloa2

PDB Entry: 2dlo

PDB Description: solution structure of the second lim domain of human thyroid receptor- interacting protein 6

PDB Compounds: (A:) Thyroid receptor-interacting protein 6

SCOP Domain Sequences for d2dloa2:

Sequence; same for both SEQRES and ATOM records:

>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]}
tcvvchrgldgipftvdatsqihciedfhrkfa

Timeline for d2dloa2:

• d2dloa2 is new in SCOP 1.73
  
• d2dloa2 appears in SCOP 1.75
  
• d2dloa2 appears in the current release, SCOPe 2.08