Lineage for d2dloa2 (2dlo A:43-75)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035857Protein Thyroid receptor interacting protein 6, TRIP6 [144177] (1 species)
  7. 3035858Species Human (Homo sapiens) [TaxId:9606] [144178] (2 PDB entries)
    Uniprot Q15654 279-305! Uniprot Q15654 306-337! Uniprot Q15654 363-396! Uniprot Q15654 364-396
  8. 3035862Domain d2dloa2: 2dlo A:43-75 [131561]
    Other proteins in same PDB: d2dloa3, d2dloa4
    2nd LIM domain
    complexed with zn

Details for d2dloa2

PDB Entry: 2dlo (more details)

PDB Description: solution structure of the second lim domain of human thyroid receptor- interacting protein 6
PDB Compounds: (A:) Thyroid receptor-interacting protein 6

SCOPe Domain Sequences for d2dloa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]}
tcvvchrgldgipftvdatsqihciedfhrkfa

SCOPe Domain Coordinates for d2dloa2:

Click to download the PDB-style file with coordinates for d2dloa2.
(The format of our PDB-style files is described here.)

Timeline for d2dloa2: