Lineage for d2dloa1 (2dlo A:8-42)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750327Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 750440Protein Thyroid receptor interacting protein 6, TRIP6 [144177] (1 species)
  7. 750441Species Human (Homo sapiens) [TaxId:9606] [144178] (2 PDB entries)
  8. 750444Domain d2dloa1: 2dlo A:8-42 [131560]
    2nd LIM domain
    complexed with zn

Details for d2dloa1

PDB Entry: 2dlo (more details)

PDB Description: solution structure of the second lim domain of human thyroid receptor- interacting protein 6
PDB Compounds: (A:) Thyroid receptor-interacting protein 6

SCOP Domain Sequences for d2dloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]}
egcyvatlekcatcsqpildrilramgkayhpgcf

SCOP Domain Coordinates for d2dloa1:

Click to download the PDB-style file with coordinates for d2dloa1.
(The format of our PDB-style files is described here.)

Timeline for d2dloa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dloa2