| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc finger protein 692, ZNF692 [144139] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144140] (1 PDB entry) Uniprot Q9BU19 328-357! Uniprot Q9BU19 358-393 |
| Domain d2dlka1: 2dlk A:8-37 [131558] complexed with zn |
PDB Entry: 2dlk (more details)
SCOPe Domain Sequences for d2dlka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]}
mpcdfpgcgrifsnrqylnhhkkyqhihqk
Timeline for d2dlka1: