Lineage for d2dkqa1 (2dkq A:8-154)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673212Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 673265Protein Tensin [141421] (2 species)
  7. 673268Species Human (Homo sapiens) [TaxId:9606] [141422] (1 PDB entry)
    Tensin2
  8. 673269Domain d2dkqa1: 2dkq A:8-154 [131556]

Details for d2dkqa1

PDB Entry: 2dkq (more details)

PDB Description: Solution structure of the PTB domain of KIAA1075 protein from human
PDB Compounds: (A:) KIAA1075 protein

SCOP Domain Sequences for d2dkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]}
mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqg
itltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvch
lfaeldpdqpagaivtfitkvllgqrk

SCOP Domain Coordinates for d2dkqa1:

Click to download the PDB-style file with coordinates for d2dkqa1.
(The format of our PDB-style files is described here.)

Timeline for d2dkqa1: