Lineage for d2dkla1 (2dkl A:8-79)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763687Protein Trinucleotide repeat containing 6c protein, TNRC6C [140333] (1 species)
  7. 763688Species Human (Homo sapiens) [TaxId:9606] [140334] (1 PDB entry)
    Uniprot Q86UE5 197-268
  8. 763689Domain d2dkla1: 2dkl A:8-79 [131555]

Details for d2dkla1

PDB Entry: 2dkl (more details)

PDB Description: solution structure of the uba domain in the human trinucleotide repeat containing 6c protein (htnrc6c)
PDB Compounds: (A:) Trinucleotide Repeat Containing 6C Protein

SCOP Domain Sequences for d2dkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]}
gmktsgkqdeawimsrlikqltdmgfprepaeealksnnmnldqamsallekkvdvdkrg
lgvtdhngmaak

SCOP Domain Coordinates for d2dkla1:

Click to download the PDB-style file with coordinates for d2dkla1.
(The format of our PDB-style files is described here.)

Timeline for d2dkla1: