Lineage for d2dk1a1 (2dk1 A:8-44)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. Family b.72.1.1: WW domain [51046] (13 proteins)
  6. Protein WW domain-binding protein 4, WBP4 [141556] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [141557] (1 PDB entry)
    Uniprot O75554 126-163
  8. Domain d2dk1a1: 2dk1 A:8-44 [131550]
    Other proteins in same PDB: d2dk1a2, d2dk1a3

Details for d2dk1a1

PDB Entry: 2dk1 (more details)

PDB Description: Solution structure of WW domain in WW domain binding protein 4 (WBP-4)
PDB Compounds: (A:) WW domain-binding protein 4

SCOPe Domain Sequences for d2dk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dk1a1 b.72.1.1 (A:8-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]}
rwvegitsegyhyyydlisgasqwekpegfqgdlkkt

SCOPe Domain Coordinates for d2dk1a1 are not available.

Timeline for d2dk1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dk1a2, d2dk1a3