Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Ephrin type-B receptor 1 [141035] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141036] (1 PDB entry) Uniprot P54762 434-528 |
Domain d2djsa1: 2djs A:8-102 [131549] |
PDB Entry: 2djs (more details)
SCOPe Domain Sequences for d2djsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} pstvpimhqvsatmrsitlswpqpeqpngiildyeiryyekehnefnssmarsqtntari dglrpgmvyvvqvrartvagygkfsgkmcfqtltd
Timeline for d2djsa1: