Lineage for d2djja1 (2djj A:6-121)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699191Family c.47.1.2: PDI-like [52849] (2 proteins)
    duplication: contains two tandem repeats of this fold
  6. 699204Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 699230Species Fungi (Humicola insolens) [TaxId:34413] [142357] (2 PDB entries)
  8. 699231Domain d2djja1: 2djj A:6-121 [131547]
    domain A' only, corresponds to the 4th domain of yeast PDI (2B5E)

Details for d2djja1

PDB Entry: 2djj (more details)

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
PDB Compounds: (A:) Protein disulfide-isomerase

SCOP Domain Sequences for d2djja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

SCOP Domain Coordinates for d2djja1:

Click to download the PDB-style file with coordinates for d2djja1.
(The format of our PDB-style files is described here.)

Timeline for d2djja1: