SCOPe 2.08: Domain d2djja1: 2djj A:6-121

Lineage for d2djja1 (2djj A:6-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein Protein disulfide isomerase, PDI [52850] (5 species)

7. Species Fungus (Humicola insolens) [TaxId:34413] [142357] (3 PDB entries)
   Uniprot P55059 227-355! Uniprot P55059 350-459

8. Domain d2djja1: 2djj A:6-121 [131547]
   Other proteins in same PDB: d2djja2
   domain A' only, corresponds to the 4th domain of yeast PDI (2B5E)

Details for d2djja1

PDB Entry: 2djj

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide isomerase

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2djja1:

Sequence; same for both SEQRES and ATOM records:

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungus (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

Timeline for d2djja1:

• d2djja1 first appeared in SCOP 1.73
  
• d2djja1 appears in SCOPe 2.07