Lineage for d2djia2 (2dji A:3-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694612Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 694711Protein Pyruvate oxidase [88729] (2 species)
  7. 694712Species Aerococcus viridans [TaxId:1377] [142203] (4 PDB entries)
  8. 694713Domain d2djia2: 2dji A:3-186 [131545]
    Other proteins in same PDB: d2djia1, d2djia3
    automatically matched to 1V5E A:3-186
    complexed with fad, so4

Details for d2djia2

PDB Entry: 2dji (more details), 1.6 Å

PDB Description: Crystal Structure of Pyruvate Oxidase from Aerococcus viridans containing FAD
PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d2djia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]}
dnkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaav
mqskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqn
pmydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssan
slrk

SCOP Domain Coordinates for d2djia2:

Click to download the PDB-style file with coordinates for d2djia2.
(The format of our PDB-style files is described here.)

Timeline for d2djia2: