Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily) alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander |
Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) |
Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins) |
Protein automated matches [190600] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187618] (2 PDB entries) |
Domain d2djha_: 2djh A: [131543] automated match to d2a8ka1 complexed with 3pd |
PDB Entry: 2djh (more details), 1.9 Å
SCOPe Domain Sequences for d2djha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2djha_ d.243.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]} kipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvy gspgkyvvvndrtgevtqisdktdpgwvddsriqwg
Timeline for d2djha_: