Lineage for d2djha_ (2djh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008616Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 3008617Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 3008624Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins)
  6. 3008635Protein automated matches [190600] (1 species)
    not a true protein
  7. 3008636Species Escherichia coli [TaxId:562] [187618] (2 PDB entries)
  8. 3008638Domain d2djha_: 2djh A: [131543]
    automated match to d2a8ka1
    complexed with 3pd

Details for d2djha_

PDB Entry: 2djh (more details), 1.9 Å

PDB Description: Crystal structure of the carboxy-terminal ribonuclease domain of Colicin E5
PDB Compounds: (A:) Colicin-E5

SCOPe Domain Sequences for d2djha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djha_ d.243.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
kipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvy
gspgkyvvvndrtgevtqisdktdpgwvddsriqwg

SCOPe Domain Coordinates for d2djha_:

Click to download the PDB-style file with coordinates for d2djha_.
(The format of our PDB-style files is described here.)

Timeline for d2djha_: