SCOPe 2.06: Domain d2djga_: 2djg A:

Lineage for d2djga_ (2djg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families)
   automatically mapped to Pfam PF08773

5. Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)

6. Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)

8. Domain d2djga_: 2djg A: [131542]
   automated match to d1k3ba_
   complexed with cl, nag, so4

Details for d2djga_

PDB Entry: 2djg, 2.05 Å

PDB Description: re-determination of the native structure of human dipeptidyl peptidase i (cathepsin c)

PDB Compounds: (A:) Dipeptidyl-peptidase 1

SCOPe Domain Sequences for d2djga_:

Sequence, based on SEQRES records:

>d2djga_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

Sequence, based on observed residues (ATOM records):

>d2djga_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykkvttycnetmtgwvhdvlgrnwacftgkkv

Timeline for d2djga_:

• d2djga_ first appeared in SCOP 1.73, called d2djga1
  
• d2djga_ appears in SCOPe 2.05
  
• d2djga_ appears in SCOPe 2.07
  
• d2djga_ appears in the current release, SCOPe 2.08