Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) automatically mapped to Pfam PF08773 |
Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein) |
Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75004] (15 PDB entries) |
Domain d2djfa_: 2djf A: [131541] automated match to d1k3ba_ complexed with 1zb, acy, cl, nag |
PDB Entry: 2djf (more details), 2 Å
SCOPe Domain Sequences for d2djfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2djfa_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]} dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
Timeline for d2djfa_: