Class g: Small proteins [56992] (94 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Actin-binding LIM protein 3, abLIM-3 [144179] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144180] (1 PDB entry) Uniprot O94929 141-176! Uniprot O94929 177-207 |
Domain d2dj7a2: 2dj7 A:8-43 [131539] Other proteins in same PDB: d2dj7a3, d2dj7a4 complexed with zn |
PDB Entry: 2dj7 (more details)
SCOPe Domain Sequences for d2dj7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} kpikirgpshcagckeeikhgqsllaldkqwhvscf
Timeline for d2dj7a2: