Lineage for d2dj7a2 (2dj7 A:8-43)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262386Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2262393Protein Actin-binding LIM protein 3, abLIM-3 [144179] (1 species)
  7. 2262394Species Human (Homo sapiens) [TaxId:9606] [144180] (1 PDB entry)
    Uniprot O94929 141-176! Uniprot O94929 177-207
  8. 2262396Domain d2dj7a2: 2dj7 A:8-43 [131539]
    Other proteins in same PDB: d2dj7a3, d2dj7a4
    complexed with zn

Details for d2dj7a2

PDB Entry: 2dj7 (more details)

PDB Description: solution structure of 3rd lim domain of actin-binding lim protein 3
PDB Compounds: (A:) Actin-binding LIM protein 3

SCOPe Domain Sequences for d2dj7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]}
kpikirgpshcagckeeikhgqsllaldkqwhvscf

SCOPe Domain Coordinates for d2dj7a2:

Click to download the PDB-style file with coordinates for d2dj7a2.
(The format of our PDB-style files is described here.)

Timeline for d2dj7a2: