Lineage for d2dj7a1 (2dj7 A:44-74)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965315Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 1965322Protein Actin-binding LIM protein 3, abLIM-3 [144179] (1 species)
  7. 1965323Species Human (Homo sapiens) [TaxId:9606] [144180] (1 PDB entry)
    Uniprot O94929 141-176! Uniprot O94929 177-207
  8. 1965324Domain d2dj7a1: 2dj7 A:44-74 [131538]
    complexed with zn

Details for d2dj7a1

PDB Entry: 2dj7 (more details)

PDB Description: solution structure of 3rd lim domain of actin-binding lim protein 3
PDB Compounds: (A:) Actin-binding LIM protein 3

SCOPe Domain Sequences for d2dj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]}
kcqtcsviltgeyiskdgvpycesdyhaqfg

SCOPe Domain Coordinates for d2dj7a1:

Click to download the PDB-style file with coordinates for d2dj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2dj7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dj7a2