SCOP 1.73: Domain d2dj5a1: 2dj5 A:1-125

Lineage for d2dj5a1 (2dj5 A:1-125)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.92: Chelatase-like [53799] (2 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (3 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.3: CbiX-like [110742] (1 protein)
   Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit

6. Protein Sirohydrochlorin cobaltochelatase CbiX [110743] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110744] (2 PDB entries)

8. Domain d2dj5a1: 2dj5 A:1-125 [131536]
   automatically matched to d1tjna_
   complexed with gol, po4

Details for d2dj5a1

PDB Entry: 2dj5, 2.55 Å

PDB Description: crystal structure of the vitamin b12 biosynthetic cobaltochelatase, cbixs, from archaeoglobus fulgidus

PDB Compounds: (A:) sirohydrochlorin cobaltochelatase

SCOP Domain Sequences for d2dj5a1:

Sequence; same for both SEQRES and ATOM records:

>d2dj5a1 c.92.1.3 (A:1-125) Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
vfrig

Timeline for d2dj5a1:

• d2dj5a1 is new in SCOP 1.73
  
• d2dj5a1 appears in SCOP 1.75
  
• d2dj5a1 appears in the current release, SCOPe 2.08, called d2dj5a2