![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.3: CbiX-like [110742] (2 proteins) Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit |
![]() | Protein automated matches [190267] (1 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [187056] (3 PDB entries) |
![]() | Domain d2dj5a2: 2dj5 A:1-125 [131536] Other proteins in same PDB: d2dj5a3 automated match to d1tjna_ complexed with gol, po4 |
PDB Entry: 2dj5 (more details), 2.55 Å
SCOPe Domain Sequences for d2dj5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dj5a2 c.92.1.3 (A:1-125) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns vfrig
Timeline for d2dj5a2: