Lineage for d2dixa1 (2dix A:7-79)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904271Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1904295Protein Interferon-inducible double stranded RNA-dependent protein kinase activator A [143204] (1 species)
  7. 1904296Species Human (Homo sapiens) [TaxId:9606] [143205] (1 PDB entry)
    Uniprot O75569 32-104
  8. 1904297Domain d2dixa1: 2dix A:7-79 [131534]

Details for d2dixa1

PDB Entry: 2dix (more details)

PDB Description: solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
PDB Compounds: (A:) Interferon-inducible double stranded RNA-dependent protein kinase activator A

SCOPe Domain Sequences for d2dixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]}
gktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskklakhra
aeaainilkanas

SCOPe Domain Coordinates for d2dixa1:

Click to download the PDB-style file with coordinates for d2dixa1.
(The format of our PDB-style files is described here.)

Timeline for d2dixa1: