SCOP 1.73: Domain d2dixa1: 2dix A:7-79

Lineage for d2dixa1 (2dix A:7-79)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
   Pfam PF00035

6. Protein Interferon-inducible double stranded RNA-dependent protein kinase activator A [143204] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143205] (1 PDB entry)

8. Domain d2dixa1: 2dix A:7-79 [131534]

Details for d2dixa1

PDB Entry: 2dix

PDB Description: solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase

PDB Compounds: (A:) Interferon-inducible double stranded RNA-dependent protein kinase activator A

SCOP Domain Sequences for d2dixa1:

Sequence; same for both SEQRES and ATOM records:

>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]}
gktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskklakhra
aeaainilkanas

Timeline for d2dixa1:

• d2dixa1 is new in SCOP 1.73
  
• d2dixa1 appears in SCOP 1.75
  
• d2dixa1 appears in the current release, SCOPe 2.08