Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) |
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
Protein Interferon-inducible double stranded RNA-dependent protein kinase activator A [143204] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143205] (1 PDB entry) Uniprot O75569 32-104 |
Domain d2dixa1: 2dix A:8-78 [131534] Other proteins in same PDB: d2dixa2, d2dixa3 |
PDB Entry: 2dix (more details)
SCOPe Domain Sequences for d2dixa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dixa1 d.50.1.1 (A:8-78) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} ktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskklakhraa eaainilkana
Timeline for d2dixa1: