Lineage for d2dixa1 (2dix A:8-78)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170232Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2170233Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2170234Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 protein domains)
    Pfam PF00035
  6. 2170258Protein Interferon-inducible double stranded RNA-dependent protein kinase activator A [143204] (1 species)
  7. 2170259Species Human (Homo sapiens) [TaxId:9606] [143205] (1 PDB entry)
    Uniprot O75569 32-104
  8. 2170260Domain d2dixa1: 2dix A:8-78 [131534]
    Other proteins in same PDB: d2dixa2, d2dixa3

Details for d2dixa1

PDB Entry: 2dix (more details)

PDB Description: Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase
PDB Compounds: (A:) Interferon-inducible double stranded RNA-dependent protein kinase activator A

SCOPe Domain Sequences for d2dixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dixa1 d.50.1.1 (A:8-78) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]}
ktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskklakhraa
eaainilkana

SCOPe Domain Coordinates for d2dixa1:

Click to download the PDB-style file with coordinates for d2dixa1.
(The format of our PDB-style files is described here.)

Timeline for d2dixa1: