Lineage for d2disa1 (2dis A:8-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951942Protein Hypothetical protein FLJ20273 [143328] (1 species)
  7. 2951943Species Human (Homo sapiens) [TaxId:9606] [143329] (1 PDB entry)
    Uniprot Q8NI52 150-245
  8. 2951944Domain d2disa1: 2dis A:8-103 [131532]
    Other proteins in same PDB: d2disa2, d2disa3

Details for d2disa1

PDB Entry: 2dis (more details)

PDB Description: solution structure of the rrm domain of unnamed protein product
PDB Compounds: (A:) unnamed protein product

SCOPe Domain Sequences for d2disa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}
ncrlfiggipkmkkreeileeiakvtegvldvivyasaadkmknrgfafveyeshraaam
arrklmpgriqlwghqiavdwaepeidvdedvmetv

SCOPe Domain Coordinates for d2disa1:

Click to download the PDB-style file with coordinates for d2disa1.
(The format of our PDB-style files is described here.)

Timeline for d2disa1: