Lineage for d2diia1 (2dii A:8-55)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738079Fold a.240: BSD domain-like [140382] (1 superfamily)
    core: 3 helices; triangular array; the extra N-terminal and C-terminal helices form a coiled coil structure
  4. 2738080Superfamily a.240.1: BSD domain-like [140383] (1 family) (S)
  5. 2738081Family a.240.1.1: BSD domain [140384] (2 proteins)
    Pfam PF03909
  6. 2738085Protein TFIIH basal transcription factor complex p62 subunit, BTF2 [140385] (1 species)
  7. 2738086Species Human (Homo sapiens) [TaxId:9606] [140386] (1 PDB entry)
    Uniprot P32780 103-150
  8. 2738087Domain d2diia1: 2dii A:8-55 [131530]
    Other proteins in same PDB: d2diia2, d2diia3
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2diia1

PDB Entry: 2dii (more details)

PDB Description: solution structure of the bsd domain of human tfiih basal transcription factor complex p62 subunit
PDB Compounds: (A:) TFIIH basal transcription factor complex p62 subunit

SCOPe Domain Sequences for d2diia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diia1 a.240.1.1 (A:8-55) TFIIH basal transcription factor complex p62 subunit, BTF2 {Human (Homo sapiens) [TaxId: 9606]}
fkrkankeleeknrmlqedpvlfqlykdlvvsqvisaeefwanrlnvn

SCOPe Domain Coordinates for d2diia1:

Click to download the PDB-style file with coordinates for d2diia1.
(The format of our PDB-style files is described here.)

Timeline for d2diia1: