![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
![]() | Protein Filamin b [141025] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries) Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192 |
![]() | Domain d2di8a1: 2di8 A:8-105 [131524] Other proteins in same PDB: d2di8a2, d2di8a3 19th repeat |
PDB Entry: 2di8 (more details)
SCOPe Domain Sequences for d2di8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} igdarrakvygrglsegrtfemsdfivdtrdagyggislavegpskvdiqtedledgtck vsyfptvpgvyivstkfadehvpgspftvkisgegrvk
Timeline for d2di8a1: